PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02595.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 359aa    MW: 40389.1 Da    PI: 5.9276
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02595.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.25.5e-52161441128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPt+eel+++yL+kkv++ k++l +vi++vd++k+ePwd+++  k+ +  +++wyfFs++dkky+tg+r+nrat++g+W
  Rsa1.0_02595.1_g00003.1  16 VPPGFRFHPTEEELLQYYLRKKVNSIKIDL-DVIRDVDLNKLEPWDIQEmcKIGTtPQNDWYFFSHKDKKYPTGTRTNRATTAGFW 100
                              69****************************.9***************962433332455*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              katg+dk ++s +g+ +g++ktLvfykgrap+g+k+dW+mheyrl
  Rsa1.0_02595.1_g00003.1 101 KATGRDKIIYS-NGRRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 144
                              ***********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.93E-5910180IPR003441NAC domain
PROSITE profilePS5100556.45216180IPR003441NAC domain
PfamPF023651.0E-2717144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MMSESMSISV NGQSQVPPGF RFHPTEEELL QYYLRKKVNS IKIDLDVIRD VDLNKLEPWD  60
IQEMCKIGTT PQNDWYFFSH KDKKYPTGTR TNRATTAGFW KATGRDKIIY SNGRRIGMRK  120
TLVFYKGRAP HGQKSDWIMH EYRLDDNIIS SEDVTLCEVV TVTGEASQDE GWVVCRIFKK  180
KNLHKTLNSS VGEASLSGGG DMARATSSSQ MSTDDTIEQF LELMGRSCKE ELNLDPFMKL  240
PNLESPSSQT VNNNCHVNSP DTYHDIHVNN VIDTSFVTSW AALDRLVASQ LNGPISYSIA  300
TVDESHVEQD HLALPSINRS GSYHAGLIQE YTPEMELWNT TSSLLSSSDS FRHVSNGSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-4821821170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013710750.10.0PREDICTED: NAC domain-containing protein 43
SwissprotQ84WP60.0NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A078CTB50.0A0A078CTB5_BRANA; BnaA05g01110D protein
STRINGBra004509.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77828124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.10.0NAC family protein